PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca129122G01
Common NameSPL17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 85aa    MW: 9282.42 Da    PI: 9.0717
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca129122G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.86.8e-243885148
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
              SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
                     +Cqve+C adl++ak+yhrrhkvCe+hska+++lv +++qrfCqqCsr
  Gh_Sca129122G01 38 VCQVEDCGADLTNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSR 85
                     6**********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.0E-253185IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.9913685IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-223785IPR004333Transcription factor, SBP-box
PfamPF031102.3E-173985IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
LGGQGDHGYP ISQGEMKNWE GTSGKKTKLN GGSGNRAVCQ VEDCGADLTN AKDYHRRHKV  60
CEMHSKASKA LVGNVMQRFC QQCSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A9e-243485152squamosa promoter-binding protein-like 12
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223251e-141KJ622325.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490238.18e-54PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9S7P56e-29SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A088DKZ67e-54A0A088DKZ6_G
TrEMBLA0A0B0MYY26e-54A0A0B0MYY2_G
TrEMBLA0A0D2P7I59e-54A0A0D2P7I5_G
STRINGPOPTR_0002s18970.12e-36(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.13e-30squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]